plasmid plvx mcherry c1 (TaKaRa)
TaKaRa is a verified supplier 
TaKaRa manufactures this product 
96
Structured Review
TaKaRa
plasmid plvx mcherry c1
Plasmid Plvx Mcherry C1, supplied by TaKaRa, used in various techniques. Bioz Stars score: 96/100, based on 59 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/plvx+vector/pLVX-mCherry-C1+Vector/pm42880281-752-94-96
Average 96 stars, based on 59 article reviews
Plasmid Plvx Mcherry C1, supplied by TaKaRa, used in various techniques. Bioz Stars score: 96/100, based on 59 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/plvx+vector/pLVX-mCherry-C1+Vector/pm42880281-752-94-96
Average 96 stars, based on 59 article reviews
plasmid plvx mcherry c1 - by Bioz Stars,
2026-11
96/100 stars
Images
Related Articles
Polymerase Chain Reaction:Article Title: Cell adhesion and spreading on fluid membranes through microtubules-dependent mechanotransduction. Article Snippet: The pLVX LifeActmScarlet plasmidwas prepared by first conducting PCR on the LifeActGFPtag2 plasmid (Ibidi USA 60101) using primers 5’-TCTAGAGCTACTAACTTCAGCCTGCTG-3’ and 5’-CGGTGGATCCCCTTCT TCC-3’. .. The PCR product was then cloned into the Article Title: Cell adhesion and spreading on fluid membranes through microtubules-dependent mechanotransduction Article Snippet: The pLVX LifeAct-mScarlet plasmid was prepared by first conducting PCR on the LifeAct-GFPtag2 plasmid (Ibidi USA 60101) using primers 5’-TCTAGAGCTACTAACTTCAGCCTGCTG-3’ and 5’-CGGTGGATCCCCTTCTTCC-3’. .. The PCR product was then cloned into the Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy. Article Snippet: .. Plasmids and stable cell line construction The mouse Dcn gene was PCR amplified and subcloned into the Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy Article Snippet: .. The mouse Dcn gene was PCR amplified and subcloned into the Clone Assay:Article Title: Cell adhesion and spreading on fluid membranes through microtubules-dependent mechanotransduction. Article Snippet: The pLVX LifeActmScarlet plasmidwas prepared by first conducting PCR on the LifeActGFPtag2 plasmid (Ibidi USA 60101) using primers 5’-TCTAGAGCTACTAACTTCAGCCTGCTG-3’ and 5’-CGGTGGATCCCCTTCT TCC-3’. .. The PCR product was then cloned into the Article Title: Cx58 is associated with the metastasis of non-small cell lung cancer via MEF2B/Cx58 axis. Article Snippet: All coverslips were visualized via a DMI8 confocal microscope (Leica Wetzlar, Germany). .. Lentivirus production and infection Small hairpin RNAs (shRNAs) were cloned and inserted into the Article Title: Membrane-anchored tissue inhibitor of matrix metalloproteinase (TIMP)-1 promotes cell death in head and neck cancer by inducing DNA damage, accumulating collagen II and disrupting cell survival mechanisms. Article Snippet: Head and neck squamous cell carcinoma (HNSCC) remains a significant global health challenge with limited therapeutic options.. Here, we investigate a novel membrane-anchored variant of Tissue Inhibitor of Matrix Metalloproteinase-1 (TIMP-1), designated T1Pr, as a potential therapeutic agent against HNSCC.. Utilizing a comprehensive approach involving biochemical, cellular, animal, mRNA-sequencing, and omics techniques, we demonstrate that T1Pr exhibits remarkable anti-tumorigenic effects in CAL27 cells in vitro and in vivo. Article Title: Cell adhesion and spreading on fluid membranes through microtubules-dependent mechanotransduction Article Snippet: The pLVX LifeAct-mScarlet plasmid was prepared by first conducting PCR on the LifeAct-GFPtag2 plasmid (Ibidi USA 60101) using primers 5’-TCTAGAGCTACTAACTTCAGCCTGCTG-3’ and 5’-CGGTGGATCCCCTTCTTCC-3’. .. The PCR product was then cloned into the Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Infection:Article Title: Cx58 is associated with the metastasis of non-small cell lung cancer via MEF2B/Cx58 axis. Article Snippet: All coverslips were visualized via a DMI8 confocal microscope (Leica Wetzlar, Germany). .. Lentivirus production and infection Small hairpin RNAs (shRNAs) were cloned and inserted into the Plasmid Preparation:Article Title: Cx58 is associated with the metastasis of non-small cell lung cancer via MEF2B/Cx58 axis. Article Snippet: All coverslips were visualized via a DMI8 confocal microscope (Leica Wetzlar, Germany). .. Lentivirus production and infection Small hairpin RNAs (shRNAs) were cloned and inserted into the Article Title: Membrane-anchored tissue inhibitor of matrix metalloproteinase (TIMP)-1 promotes cell death in head and neck cancer by inducing DNA damage, accumulating collagen II and disrupting cell survival mechanisms. Article Snippet: Head and neck squamous cell carcinoma (HNSCC) remains a significant global health challenge with limited therapeutic options.. Here, we investigate a novel membrane-anchored variant of Tissue Inhibitor of Matrix Metalloproteinase-1 (TIMP-1), designated T1Pr, as a potential therapeutic agent against HNSCC.. Utilizing a comprehensive approach involving biochemical, cellular, animal, mRNA-sequencing, and omics techniques, we demonstrate that T1Pr exhibits remarkable anti-tumorigenic effects in CAL27 cells in vitro and in vivo. Article Title: Targeting Hepatocellular Carcinoma Growth: Haprolid’s Inhibition of AKT Signaling Through DExH-Box Helicase 9 Downregulation Article Snippet: .. The pLVX-Flag-DHX9 construct was created by inserting the Flag-tagged DHX9 sequence into the Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy. Article Snippet: .. Plasmids and stable cell line construction The mouse Dcn gene was PCR amplified and subcloned into the Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy Article Snippet: .. The mouse Dcn gene was PCR amplified and subcloned into the Construct:Article Title: Membrane-anchored tissue inhibitor of matrix metalloproteinase (TIMP)-1 promotes cell death in head and neck cancer by inducing DNA damage, accumulating collagen II and disrupting cell survival mechanisms. Article Snippet: Head and neck squamous cell carcinoma (HNSCC) remains a significant global health challenge with limited therapeutic options.. Here, we investigate a novel membrane-anchored variant of Tissue Inhibitor of Matrix Metalloproteinase-1 (TIMP-1), designated T1Pr, as a potential therapeutic agent against HNSCC.. Utilizing a comprehensive approach involving biochemical, cellular, animal, mRNA-sequencing, and omics techniques, we demonstrate that T1Pr exhibits remarkable anti-tumorigenic effects in CAL27 cells in vitro and in vivo. Article Title: Targeting Hepatocellular Carcinoma Growth: Haprolid’s Inhibition of AKT Signaling Through DExH-Box Helicase 9 Downregulation Article Snippet: .. The pLVX-Flag-DHX9 construct was created by inserting the Flag-tagged DHX9 sequence into the Sequencing:Article Title: Targeting Hepatocellular Carcinoma Growth: Haprolid’s Inhibition of AKT Signaling Through DExH-Box Helicase 9 Downregulation Article Snippet: .. The pLVX-Flag-DHX9 construct was created by inserting the Flag-tagged DHX9 sequence into the Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Stable Transfection:Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy. Article Snippet: .. Plasmids and stable cell line construction The mouse Dcn gene was PCR amplified and subcloned into the Amplification:Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy. Article Snippet: .. Plasmids and stable cell line construction The mouse Dcn gene was PCR amplified and subcloned into the Article Title: Decorin facilitates T cell-mediated antitumor immunity and augments the efficacy of anti-PD1 immunotherapy Article Snippet: .. The mouse Dcn gene was PCR amplified and subcloned into the Variant Assay:Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Mutagenesis:Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Binding Assay:Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a Cloning:Article Title: A universal chimeric antigen receptor (CAR)-fragment antibody binder (FAB) split system for cancer immunotherapy. Article Snippet: .. The sequence of protein GA1 variant, with a K33E mutation to reduce binding to human Fc (29) (TPAVTTYKLVINGRTLSGYTTTTAVDAATAEKVFKQYAYVHEVDGEWTYDDATKTFTVTEKPEKL), was cloned into a |